We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HOXA11 Recombinant Protein Antigen

Images

 
There are currently no images for HOXA11 Recombinant Protein Antigen (NBP2-58894PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HOXA11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXA11.

Source: E. coli

Amino Acid Sequence: LPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HOXA11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58894.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOXA11 Recombinant Protein Antigen

  • homeo box A11
  • homeobox A11
  • Homeobox protein Hox-1I
  • homeobox protein HOXA11
  • homeobox protein Hox-A11
  • HOX1
  • HOX1Ihomeo box 1I

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulnar synostosis with amegakaryocytic thrombocytopenia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-47382
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-17383
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF,  IHC-P
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-15720
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-52149
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, MiAr, PEP-ELISA
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
7734-LF
Species: Hu
Applications: BA
DY871
Species: Hu
Applications: ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-20913
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-45511
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-45002
Species: Hu
Applications: IHC, WB
NBP2-85074
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24597
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB

Publications for HOXA11 Recombinant Protein Antigen (NBP2-58894PEP) (0)

There are no publications for HOXA11 Recombinant Protein Antigen (NBP2-58894PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA11 Recombinant Protein Antigen (NBP2-58894PEP) (0)

There are no reviews for HOXA11 Recombinant Protein Antigen (NBP2-58894PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HOXA11 Recombinant Protein Antigen (NBP2-58894PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXA11 Products

Blogs on HOXA11

There are no specific blogs for HOXA11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HOXA11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA11