Recombinant Human HOOK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOOK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 138-237 of Human HOOK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LEESVQHVVMEAIQELMTKDTPDSLSPETYGNFDSQSRRYYFLSEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOOK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOOK2 Protein

  • FLJ26218
  • hHK2
  • HK2h-hook2
  • hook homolog 2 (Drosophila)
  • protein Hook homolog 2

Background

HOOK2 - hook homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
MAB4104
Species: Hu
Applications: WB, IP, Neut
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
MAB2337
Species: Hu
Applications: WB, IP
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2008
Species: Hu
Applications: WB, IHC, IP
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
AF1310
Species: Hu
Applications: WB, IHC, IP
H00000072-D01P
Species: Hu
Applications: WB
H00029911-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HOOK2 Partial Recombinant Protein (H00029911-Q01) (0)

There are no publications for HOOK2 Partial Recombinant Protein (H00029911-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOOK2 Partial Recombinant Protein (H00029911-Q01) (0)

There are no reviews for HOOK2 Partial Recombinant Protein (H00029911-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOOK2 Partial Recombinant Protein (H00029911-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOOK2 Products

Bioinformatics Tool for HOOK2 Partial Recombinant Protein (H00029911-Q01)

Discover related pathways, diseases and genes to HOOK2 Partial Recombinant Protein (H00029911-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOOK2 Partial Recombinant Protein (H00029911-Q01)

Discover more about diseases related to HOOK2 Partial Recombinant Protein (H00029911-Q01).
 

Pathways for HOOK2 Partial Recombinant Protein (H00029911-Q01)

View related products by pathway.

Blogs on HOOK2

There are no specific blogs for HOOK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOOK2 Antibody
NBP2-14986

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOOK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOOK2