Recombinant Human HLA DQB2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HLA DQB2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-231 of Human HLA-DQB2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HLA-DQB2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HLA DQB2 Protein

  • class II, DQ beta 1
  • DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB))
  • HLA-DQB1
  • major histocompatibility complex, class II, DQ beta 2

Background

HLA-DQB2( AAH31995, 1 a.a. - 232 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for HLA DQB2 Recombinant Protein (H00003120-P01) (0)

There are no publications for HLA DQB2 Recombinant Protein (H00003120-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQB2 Recombinant Protein (H00003120-P01) (0)

There are no reviews for HLA DQB2 Recombinant Protein (H00003120-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQB2 Recombinant Protein (H00003120-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA DQB2 Products

Bioinformatics Tool for HLA DQB2 Recombinant Protein (H00003120-P01)

Discover related pathways, diseases and genes to HLA DQB2 Recombinant Protein (H00003120-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DQB2 Recombinant Protein (H00003120-P01)

Discover more about diseases related to HLA DQB2 Recombinant Protein (H00003120-P01).
 

Pathways for HLA DQB2 Recombinant Protein (H00003120-P01)

View related products by pathway.

Blogs on HLA DQB2

There are no specific blogs for HLA DQB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HLA DQB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQB2