HKDC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HKDC1 Antibody [NBP2-57475] - Staining of human cell line A549 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HKDC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQAQRKQIDRVLALFQLTREQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HKDC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HKDC1 Recombinant Protein Antigen (NBP2-57475PEP)

Reactivity Notes

Mouse 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HKDC1 Antibody

  • EC 2.7.1
  • EC 2.7.1.1
  • FLJ22761
  • FLJ37767
  • hexokinase domain containing 1
  • Hexokinase domain-containing protein 1
  • MGC125688
  • putative hexokinase HKDC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-16814
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4208
Species: Rt
Applications: WB
NBP2-38799
Species: Hu
Applications: IHC, IHC-P, WB
AF3264
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-89300
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14843
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-75552
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
H00256536-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-81745
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB2337
Species: Hu
Applications: IP, WB

Publications for HKDC1 Antibody (NBP2-57475) (0)

There are no publications for HKDC1 Antibody (NBP2-57475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HKDC1 Antibody (NBP2-57475) (0)

There are no reviews for HKDC1 Antibody (NBP2-57475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HKDC1 Antibody (NBP2-57475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HKDC1 Products

Bioinformatics Tool for HKDC1 Antibody (NBP2-57475)

Discover related pathways, diseases and genes to HKDC1 Antibody (NBP2-57475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HKDC1 Antibody (NBP2-57475)

Discover more about diseases related to HKDC1 Antibody (NBP2-57475).

PTMs for HKDC1 Antibody (NBP2-57475)

Learn more about PTMs related to HKDC1 Antibody (NBP2-57475).

Blogs on HKDC1

There are no specific blogs for HKDC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HKDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HKDC1