Histone H2AY/macroH2A.1 Antibody


Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF7, Antibody Dilution: 1.0 ug/ml H2AFY is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Histone H2AY/macroH2A.1 Antibody Summary

Synthetic peptides corresponding to H2AFY(H2A histone family, member Y) The peptide sequence was selected from the N terminal of H2AFY. Peptide sequence HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against H2AFY and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Histone H2AY/macroH2A.1 Lysate (NBP2-65605)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Histone H2AY/macroH2A.1 Antibody

  • core histone macro-H2A.1
  • H2A histone family, member Y
  • H2A.y
  • H2A/y
  • H2AF12M
  • H2AFJ
  • H2AFY
  • Histone H2A.y
  • Histone H2AY
  • Histone MacroH2A1
  • histone macroH2A1.1
  • histone macroH2A1.2
  • MACROH2A1.1
  • macroH2A1.2
  • Medulloblastoma Antigen MU-MB-50.205
  • mH2A1


Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, ICC/IF, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Histone H2AY/macroH2A.1 Antibody (NBP1-53003) (0)

There are no publications for Histone H2AY/macroH2A.1 Antibody (NBP1-53003).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H2AY/macroH2A.1 Antibody (NBP1-53003) (0)

There are no reviews for Histone H2AY/macroH2A.1 Antibody (NBP1-53003). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histone H2AY/macroH2A.1 Antibody (NBP1-53003) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Histone H2AY/macroH2A.1 Products

Bioinformatics Tool for Histone H2AY/macroH2A.1 Antibody (NBP1-53003)

Discover related pathways, diseases and genes to Histone H2AY/macroH2A.1 Antibody (NBP1-53003). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H2AY/macroH2A.1 Antibody (NBP1-53003)

Discover more about diseases related to Histone H2AY/macroH2A.1 Antibody (NBP1-53003).

Pathways for Histone H2AY/macroH2A.1 Antibody (NBP1-53003)

View related products by pathway.

Blogs on Histone H2AY/macroH2A.1

There are no specific blogs for Histone H2AY/macroH2A.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Histone H2AY/macroH2A.1 Antibody and receive a gift card or discount.


Gene Symbol H2AFY