Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody

Images

 
Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [NBP1-89375] - Analysis in human brain tissue.
Immunohistochemistry-Paraffin: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [NBP1-89375] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HS3ST1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Protein (NBP1-89375PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody

  • 3OST
  • 3OST1
  • 3-OST-1
  • 3OST1Heparan sulfate 3-O-sulfotransferase 1
  • EC 2.8.2
  • EC 2.8.2.23
  • h3-OST-1
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 1
  • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1
  • heparan sulfate glucosamine 3-O-sulfotransferase 1
  • heparin-glucosamine 3-O-sulfotransferase
  • HS3ST1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49661
Species: Hu
Applications: WB, IHC
AF1267
Species: Hu
Applications: WB, IP, Neut
AF6085
Species: Hu, Mu
Applications: WB, IHC, Neut
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13645
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89373
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89375
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375) (0)

There are no publications for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375) (0)

There are no reviews for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Products

Bioinformatics Tool for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375)

Discover related pathways, diseases and genes to Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375)

Discover more about diseases related to Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375).
 

Pathways for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375)

View related products by pathway.

PTMs for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375)

Learn more about PTMs related to Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-89375).

Blogs on Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1

There are no specific blogs for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HS3ST1
Entrez