Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to HS3ST1(heparan sulfate (glucosamine) 3-O-sulfotransferase 1) The peptide sequence was selected from the middle region of HS3ST1. Peptide sequence TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HS3ST1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free
Background
HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: IHC, IP
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, WB
Publications for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-58058) (0)
There are no publications for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-58058).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-58058) (0)
There are no reviews for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-58058).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-58058) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Products
Research Areas for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (NBP1-58058)
Find related products by research area.
|
Blogs on Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1