![Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [H00009957-D01P] - Analysis of HS3ST1 expression in transfected 293T cell line by HS3ST1 polyclonal antibody.Lane 1: HS3ST1 transfected lysate(35.80 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Heparan-Sulfate-3-O-Sulfotransferase-1-HS3ST1-Antibody-Western-Blot-H00009957-D01P-img0001.jpg "Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [H00009957-D01P] - Analysis of HS3ST1 expression in transfected 293T cell line by HS3ST1 polyclonal antibody.Lane 1: HS3ST1 transfected lysate(35.80 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | HS3ST1 (NP_005105.1, 1 a.a. - 307 a.a.) full-length human protein. MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HS3ST1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Immunohistochemistry Heparan Sulfate 3-O-Sulfotransferase 4/HS3ST4 Antibody [Unconjugated]](https://images.novusbio.com/images2/HS3ST4_AF6085_Immunohistochemistry_11798.jpg)
![Western Blot Heparan Sulfate 3-O-Sulfotransferase 4/HS3ST4 Antibody [Unconjugated]](https://images.novusbio.com/images2/HS3ST4_AF6085_Western_Blot_9395.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody (H00009957-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HS3ST1 |
| Uniprot |
|
![Serpin C1/Antithrombin-III Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Serpin C1/Antithrombin-III Antibody [Unconjugated]")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")