Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - Azide and BSA Free

Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [H00009957-B01P] - Analysis of HS3ST1 expression in transfected 293T cell line by HS3ST1 polyclonal antibody. Lane 1: HS3ST1 transfected lysate(33.77 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - Azide and BSA Free Summary

• Immunogen: HS3ST1 (NP_005105.1, 1 a.a. - 307 a.a.) full-length human protein. MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
• Specificity: HS3ST1 - heparan sulfate (glucosamine) 3-O-sulfotransferase 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HS3ST1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - Azide and BSA Free

• 3OST
• 3OST1
• 3-OST-1
• 3OST1Heparan sulfate 3-O-sulfotransferase 1
• EC 2.8.2
• EC 2.8.2.23
• h3-OST-1
• heparan sulfate (glucosamine) 3-O-sulfotransferase 1
• Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1
• heparan sulfate glucosamine 3-O-sulfotransferase 1
• heparin-glucosamine 3-O-sulfotransferase
• HS3ST1

Background

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HS3ST1
• Entrez:
  • 9957(Human)
• Uniprot:
  • NP_005105.1(Human)