Novus Biologicals products are now on bio-techne.com

HEMK2 Antibody (1C4)

Images

 
Western Blot: HEMK2 Antibody (1C4) [H00029104-M01] - Detection against Immunogen (36.74 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HEMK2 Antibody (1C4) Summary

Immunogen
HEMK2 (NP_877426, 87 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Specificity
HEMK2 - HemK methyltransferase family member 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
N6AMT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HEMK2 Antibody (1C4)

  • C21orf127
  • chromosome 21 open reading frame 127
  • EC 2.1.1.-
  • HemK methyltransferase family member 2
  • HEMK2
  • m.HsaHemK2P
  • MGC19995
  • MTQ2
  • N(6)-adenine-specific DNA methyltransferase 1
  • N-6 adenine-specific DNA methyltransferase 1 (putative)
  • N6AMT
  • N6-DNA-methyltransferase
  • PRED28

Background

The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31113
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-86906
Species: Hu
Applications: IHC, IHC-P, WB
AF5059
Species: Hu
Applications: IHC, WB
NB100-1131
Species: ArHa, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00009617-B01P
Species: Hu
Applications: WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP2-44300
Species: Hu
Applications: Flow-CS, ICC/IF, IHC, IHC-P, WB
NBP2-43745
Species: Hu, Mu
Applications: Flow, IHC, IHC-Fr, WB
NBP1-81019
Species: Hu
Applications: IHC, IHC-P, WB
H00060487-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00054456-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-59777
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-88402
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-92009
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00029104-M01
Species: Hu
Applications: WB, ELISA

Publications for HEMK2 Antibody (H00029104-M01) (0)

There are no publications for HEMK2 Antibody (H00029104-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEMK2 Antibody (H00029104-M01) (0)

There are no reviews for HEMK2 Antibody (H00029104-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HEMK2 Antibody (H00029104-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HEMK2 Products

Research Areas for HEMK2 Antibody (H00029104-M01)

Find related products by research area.

Blogs on HEMK2

There are no specific blogs for HEMK2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEMK2 Antibody (1C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol N6AMT1
Entrez
Uniprot