HCC1 Recombinant Protein Antigen

Images

 
There are currently no images for HCC1 Protein (NBP1-88200PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HCC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBM39.

Source: E. coli

Amino Acid Sequence: LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBM39
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88200.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HCC1 Recombinant Protein Antigen

  • CAPER alpha
  • CAPER
  • CAPERalpha
  • CC1.3
  • coactivator of activating protein-1 and estrogen receptors
  • DKFZp781C0423
  • FLJ44170
  • fSAP59
  • functional spliceosome-associated protein 59
  • HCC1
  • HCC1CAPERalpha
  • Hepatocellular carcinoma protein 1
  • RBM39
  • RNA binding motif protein 39
  • RNA-binding motif protein 39
  • RNA-binding protein 39
  • RNA-binding region-containing protein 2
  • RNPC2
  • RRM) containing 2
  • splicing factor CC1.3
  • Splicing factor HCC1

Background

HCC1 is encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-335
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-92553
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr,  IHC-P
DY805
Species: Hu
Applications: ELISA
NBP3-16432
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
7954-GM/CF
Species: Hu
Applications: BA
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
AF2699
Species: Mu
Applications: Simple Western, WB

Publications for HCC1 Protein (NBP1-88200PEP) (0)

There are no publications for HCC1 Protein (NBP1-88200PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HCC1 Protein (NBP1-88200PEP) (0)

There are no reviews for HCC1 Protein (NBP1-88200PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HCC1 Protein (NBP1-88200PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HCC1 Products

Research Areas for HCC1 Protein (NBP1-88200PEP)

Find related products by research area.

Blogs on HCC1

There are no specific blogs for HCC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HCC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM39