Home » HBXIP » HBXIP Antibodies » HBXIP Antibody

HBXIP Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HBXIP Antibody [NBP1-53103] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Western Blot: HBXIP Antibody [NBP1-53103] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HBXIP Antibody Summary

Immunogen
Synthetic peptides corresponding to HBXIP(hepatitis B virus x interacting protein) The peptide sequence was selected from the N terminal of HBXIP. Peptide sequence EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMTOR5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HBXIP and was validated on Western blot.
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HBXIP Antibody

  • HBV X-interacting protein
  • HBX-interacting protein
  • hepatitis B virus x interacting protein
  • hepatitis B virus x-interacting protein (9.6kD)
  • MGC71071
  • XIPhepatitis B virus X-interacting protein

Background

HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sodium Calcium
Exchanger 1/NCX1 Anti ...
NBP2-94316
Sodium Calcium Exchanger 1/NCX1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TLX2 Antibody -
BSA Free
NBP2-82023
Western Blot: TLX2 Antibody [NBP2-82023] - Analysis of TLX2 in rat brain tissue lysate with TLX2 antibody at (A) 0.5 and (B) 1 ug/ml.
Immunohistochemistry: TLX2 Antibody [NBP2-82023] - Immunohistochemistry of TLX2 in rat brain tissue with TLX2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: TLX2 Antibody [NBP2-82023] - Immunofluorescence of TLX2 in rat brain tissue with TLX2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Serpin E2/PN1
2980-PI
Serpin E2/PN1
(8 Publications)
Species: Hu
Applications: InhibAct
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry: Survivin Antibody [NB500-201] - An intracellular stain was performed on HeLa cells with [NB500-201] and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Dual RNAscope ISH-IHC: Survivin Antibody [NB500-201] - Formalin-fixed paraffin-embedded tissue sections of human esophagus squamous cell carcinoma were probed for Survivin mRNA (ACD RNAScope Probe, [465361]; Fast Red chromogen, ACD [322360]). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal [NB500-201] at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody [VC003] and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to tumor cells.
Knockdown Validated: Survivin Antibody [NB500-201] - Anti-tumor effects and functional evidence of sCA-survivin-siRNA in HCT116 and HT29 solid tumor models. Immunostaining of survivin in the tumor tissues on day 19 using [NB500-201]. Scale bar, 50 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0116022) licensed under a CC-BY licence.
(22 Reviews)
(350 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
CSP Antibody
NBP1-87974
Western Blot: CSP Antibody [NBP1-87974] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CSP Antibody [NBP1-87974] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: CSP Antibody [NBP1-87974] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu
Applications: IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
gamma-Synuclein
Antibody (JM90-32)
NBP2-66861
Flow Cytometry: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of Hela cells with gamma Synuclein antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Staining gamma Synuclein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of paraffin-embedded human breast cancer tissue using anti-gamma Synuclein antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(26 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry: Survivin Antibody [NB500-201] - An intracellular stain was performed on HeLa cells with [NB500-201] and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Dual RNAscope ISH-IHC: Survivin Antibody [NB500-201] - Formalin-fixed paraffin-embedded tissue sections of human esophagus squamous cell carcinoma were probed for Survivin mRNA (ACD RNAScope Probe, [465361]; Fast Red chromogen, ACD [322360]). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal [NB500-201] at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody [VC003] and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to tumor cells.
Knockdown Validated: Survivin Antibody [NB500-201] - Anti-tumor effects and functional evidence of sCA-survivin-siRNA in HCT116 and HT29 solid tumor models. Immunostaining of survivin in the tumor tissues on day 19 using [NB500-201]. Scale bar, 50 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0116022) licensed under a CC-BY licence.
(22 Reviews)
(350 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
SLC8A2 Antibody
NBP2-49145
Immunohistochemistry: SLC8A2 Antibody [NBP2-49145] - Staining of human cerebellum shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: SLC8A2 Antibody [NBP2-49145] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: SLC8A2 Antibody [NBP2-49145] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Sodium-Calcium
Exchanger Antibody (C ...
NB120-2869
Immunocytochemistry/Immunofluorescence: Sodium-Calcium Exchanger Antibody (C2C12) [NB120-2869] - Sodium/Calcium Exchanger staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. A2058 cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Sodium/Calcium Exchanger at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary.
Immunocytochemistry/Immunofluorescence: Sodium-Calcium Exchanger Antibody (C2C12) [NB120-2869] - Sodium/Calcium Exchanger staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. A549 cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Sodium/Calcium Exchanger at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary.
Immunocytochemistry/Immunofluorescence: Sodium-Calcium Exchanger Antibody (C2C12) [NB120-2869] - Sodium/Calcium Exchanger staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. U251 cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Sodium/Calcium Exchanger at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary.
(2 Publications)
Species: Bv, Ca, Gp, Hu, I, Ma, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FAM126A Antibody
NBP1-32914
Western Blot: FAM126A Antibody [NBP1-32914] - Sample (50 ug of whole cell lysate) A: mouse brain 7. 5% SDS PAGE, antibody diluted at 1:3000.
Western Blot: FAM126A Antibody [NBP1-32914] - Sample (30 ug of whole cell lysate) A: Raji 7. 5% SDS PAGE; antibody diluted at 1:10000.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for HBXIP Antibody (NBP1-53103) (0)

There are no publications for HBXIP Antibody (NBP1-53103).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBXIP Antibody (NBP1-53103) (0)

There are no reviews for HBXIP Antibody (NBP1-53103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HBXIP Antibody (NBP1-53103) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HBXIP Products

Bioinformatics Tool for HBXIP Antibody (NBP1-53103)

Discover related pathways, diseases and genes to HBXIP Antibody (NBP1-53103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for HBXIP Antibody (NBP1-53103)

Find related products by research area.

Blogs on HBXIP

There are no specific blogs for HBXIP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HBXIP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LAMTOR5