![Western Blot: HBO1 Antibody (2G5) [H00011143-M01] - Analysis of MYST2 over-expressed 293 cell line, cotransfected with MYST2 Validated Chimera RNAi ( Cat # H00011143-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYST2 monoclonal antibody (M01), clone 2G5 (Cat # H00011143-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/HBO1-Antibody-2G5-Western-Blot-H00011143-M01-img0003.jpg "Western Blot: HBO1 Antibody (2G5) [H00011143-M01] - Analysis of MYST2 over-expressed 293 cell line, cotransfected with MYST2 Validated Chimera RNAi ( Cat # H00011143-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYST2 monoclonal antibody (M01), clone 2G5 (Cat # H00011143-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Mycoplasma |
| Clone | 2G5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | MYST2 (AAH32640, 512 a.a. ~ 611 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT |
| Specificity | MYST2 - MYST histone acetyltransferase 2 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | KAT7 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HBO1 Antibody (H00011143-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: HBO1 Antibody (2G5) [H00011143-M01] - Analysis of MYST2 expression in transfected 293T cell line by MYST2 monoclonal antibody (M01), clone 2G5.Lane 1: MYST2 transfected lysate(70.6 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/HBO1-Antibody-2G5-Western-Blot-H00011143-M01-img0004.jpg "Western Blot: HBO1 Antibody (2G5) [H00011143-M01] - Analysis of MYST2 expression in transfected 293T cell line by MYST2 monoclonal antibody (M01), clone 2G5.Lane 1: MYST2 transfected lysate(70.6 KDa).Lane 2: Non-transfected lysate.")
![Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB](https://images.novusbio.com/images/Goat-anti-Mouse-IgG-H+L-Secondary-Antibody-HRP-Immunohistochemistry-Paraffin-NB7539-img0014.jpg "Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")