Recombinant Human GTPBP6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GTPBP6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 294-402 of Human GTPBP6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:APLLDSMVEVHNKVDLVPGYSPTEPNVVPVSALRGHGLQELKAELDAAVLKATGRQILTLRVRLAGAQLSWLYKEATVQEVDVIPEDGAADVRVIISNSAYGKFRKLFP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GTPBP6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GTPBP6 Protein

  • FLJ22809
  • FLJ56662
  • FLJ56805
  • FLJ90047
  • GTP binding protein 6 (putative)
  • PGPLFLJ20977
  • Pseudoautosomal GTP-binding protein-like
  • putative GTP-binding protein 6
  • putative GTP-binding protein 6-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
DDX0300P-100
Species: Hu, Ca
Applications: Flow, IHC, IHC-Fr, IHC-P, IP
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB6130
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-49382
Species: Hu
Applications: IHC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-85219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00006192-P01
Species: Hu
NBP1-98264
Species: Hu
Applications: WB
H00009087-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85808
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB

Publications for GTPBP6 Partial Recombinant Protein (H00008225-Q01) (0)

There are no publications for GTPBP6 Partial Recombinant Protein (H00008225-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTPBP6 Partial Recombinant Protein (H00008225-Q01) (0)

There are no reviews for GTPBP6 Partial Recombinant Protein (H00008225-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTPBP6 Partial Recombinant Protein (H00008225-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTPBP6 Products

Bioinformatics Tool for GTPBP6 Partial Recombinant Protein (H00008225-Q01)

Discover related pathways, diseases and genes to GTPBP6 Partial Recombinant Protein (H00008225-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTPBP6 Partial Recombinant Protein (H00008225-Q01)

Discover more about diseases related to GTPBP6 Partial Recombinant Protein (H00008225-Q01).
 

Pathways for GTPBP6 Partial Recombinant Protein (H00008225-Q01)

View related products by pathway.

Blogs on GTPBP6

There are no specific blogs for GTPBP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GTPBP6 Antibody
NBP1-83631

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GTPBP6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GTPBP6