GTF2H2 Antibody

Western Blot: GTF2H2 Antibody [H00002966-B01P] - Analysis of GTF2H2 expression in human pancreas.

Immunocytochemistry/Immunofluorescence: GTF2H2 Antibody [H00002966-B01P] - Analysis of purified antibody to GTF2H2 on HepG2 cell. (antibody concentration 10 ug/ml)

Western Blot: GTF2H2 Antibody [H00002966-B01P] - Analysis of GTF2H2 expression in transfected 293T cell line by GTF2H2 polyclonal antibody. Lane 1: GTF2H2 transfected lysate(43.45 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

GTF2H2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GTF2H2 (NP_001506.1, 1 a.a. - 395 a.a.) full-length human protein. MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GTF2H2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTF2H2 Antibody

• Basic transcription factor 2 44 kDa subunit
• BTF2 p44
• BTF2
• BTF2P44TFIIH basal transcription factor complex p44 subunit
• General transcription factor IIH polypeptide 2
• general transcription factor IIH subunit 2
• general transcription factor IIH, polypeptide 2 (44kD subunit)
• general transcription factor IIH, polypeptide 2, 44kD subunit
• general transcription factor IIH, polypeptide 2, 44kDa
• MGC102806
• T-BTF2P44
• TFIIH

Background

Initiation of transcription from protein-coding genes in eukaryotes is a complex process that requires RNA polymerase II, as well as families of basal transcription factors. Binding of the factor TFIID (TBP) to the TATA box is believed to be the first step in the formation of a multiprotein complex containing several additional factors, including TFIIA, TFIIB, TFIIE, TFIIF and TFII. TFIIH (or BTF2) is a multisubunit transcription/DNA repair factor that possesses several enzymatic activities. The core of TFIIH is composed of five subunits, designated p89 (XPB or ERCC3), p62, p52, p44 and p34. Additional subunits of the TFIIH complex are p80 (XPD or ERCC2) and the ternary kinase complex composed of Cdk7, cyclin H and MAT1. Both p89 and p80 have ATP-dependent helicase activity. The p62, p52 and p44 subunits have been shown to be involved in nucleotide excision repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTF2H2
• Uniprot:
  • NP_001506.1(Human)