GRXCR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GRXCR1 Antibody [NBP1-90591] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cell junctions.
Immunohistochemistry-Paraffin: GRXCR1 Antibody [NBP1-90591] - Staining of human nasopharynx shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRXCR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVKYKVSAGQALFNNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRXCR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRXCR1 Protein (NBP1-90591PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRXCR1 Antibody

  • DFNB25
  • glutaredoxin domain-containing cysteine-rich protein 1
  • glutaredoxin, cysteine rich 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003249-P01
Species: Hu
Applications: WB
NB300-748
Species: Hu, Rt
Applications: WB, ICC/IF
AF1928
Species: Mu
Applications: WB, IHC, IP
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
H00064699-M01
Species: Hu
Applications: WB, ELISA
NBP1-56991
Species: Hu
Applications: WB
NBP1-90588
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90591
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GRXCR1 Antibody (NBP1-90591) (0)

There are no publications for GRXCR1 Antibody (NBP1-90591).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRXCR1 Antibody (NBP1-90591) (0)

There are no reviews for GRXCR1 Antibody (NBP1-90591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GRXCR1 Antibody (NBP1-90591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRXCR1 Products

Bioinformatics Tool for GRXCR1 Antibody (NBP1-90591)

Discover related pathways, diseases and genes to GRXCR1 Antibody (NBP1-90591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRXCR1 Antibody (NBP1-90591)

Discover more about diseases related to GRXCR1 Antibody (NBP1-90591).
 

Pathways for GRXCR1 Antibody (NBP1-90591)

View related products by pathway.

Blogs on GRXCR1

There are no specific blogs for GRXCR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRXCR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRXCR1