Recombinant Human GPSM2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GPSM2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 381-480 of Human GPSM2

Source: Wheat Germ

Amino Acid Sequence: ENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEKVQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQRKISADTI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GPSM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPSM2 Protein

  • deafness, autosomal recessive 82
  • DFNB82
  • G-protein signaling modulator 2
  • G-protein signalling modulator 2 (AGS3-like, C. elegans)
  • G-protein-signaling modulator 2
  • LGNPins
  • Mosaic protein LGN
  • PINS

Background

GPSM2 - G-protein signalling modulator 2 (AGS3-like, C. elegans)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
H00028299-P01
Species: Hu
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-67796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for GPSM2 Partial Recombinant Protein (H00029899-Q01) (0)

There are no publications for GPSM2 Partial Recombinant Protein (H00029899-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPSM2 Partial Recombinant Protein (H00029899-Q01) (0)

There are no reviews for GPSM2 Partial Recombinant Protein (H00029899-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPSM2 Partial Recombinant Protein (H00029899-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPSM2 Products

Bioinformatics Tool for GPSM2 Partial Recombinant Protein (H00029899-Q01)

Discover related pathways, diseases and genes to GPSM2 Partial Recombinant Protein (H00029899-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPSM2 Partial Recombinant Protein (H00029899-Q01)

Discover more about diseases related to GPSM2 Partial Recombinant Protein (H00029899-Q01).
 

Pathways for GPSM2 Partial Recombinant Protein (H00029899-Q01)

View related products by pathway.

PTMs for GPSM2 Partial Recombinant Protein (H00029899-Q01)

Learn more about PTMs related to GPSM2 Partial Recombinant Protein (H00029899-Q01).
 

Research Areas for GPSM2 Partial Recombinant Protein (H00029899-Q01)

Find related products by research area.

Blogs on GPSM2

There are no specific blogs for GPSM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GPSM2 Antibody
NBP1-53125
NuMA Antibody
NB500-174

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPSM2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPSM2