GPRC5D Antibody (6D9) - Azide and BSA Free

Western Blot: GPRC5D Antibody (6D9) [H00055507-M01] - GPRC5D monoclonal antibody (M01), clone 6D9. Analysis of GPRC5D expression in human kidney.

ELISA: GPRC5D Antibody (6D9) [H00055507-M01] - Detection limit for recombinant GST tagged GPRC5D is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GPRC5D Antibody (6D9) - Azide and BSA Free Summary

• Immunogen: GPRC5D (NP_061124, 261 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
• Specificity: GPRC5D - G protein-coupled receptor, family C, group 5, member D
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GPRC5D
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPRC5D Antibody (6D9) - Azide and BSA Free

• G protein-coupled receptor, family C, group 5, member D
• GPRC5D
• G-protein coupled receptor family C group 5 member D
• MGC129713
• MGC129714
• orphan G-protein coupled receptor

Background

The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPRC5D
• Entrez:
  • 55507(Human)
• OMIM:
  • 607437(Human)
• Uniprot:
  • NP_061124()