GPR85 Antibody - BSA Free

Western Blot: GPR85 Antibody [NBP2-82242] - WB Suggested Anti-GPR85 Antibody. Titration: 1.0 ug/ml. Positive Control: NCI-H226 Whole CellGPR85 is supported by BioGPS gene expression data to be expressed in NCIH226

Immunohistochemistry-Paraffin: GPR85 Antibody [NBP2-82242] - Rabbit Anti-GPR85 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

Western Blot: GPR85 Antibody [NBP2-82242] - Host: Rabbit. Target Name: GPR85. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR85 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR85 Antibody - BSA Free (NBP2-82242) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR85. Peptide sequence: YFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR85
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR85 Antibody - BSA Free

• FLJ50993
• FLJ51159
• FLJ99433
• G protein-coupled receptor 85
• GPR85
• probable G-protein coupled receptor 85
• seven transmembrane helix receptor
• SREB
• SREB2
• SREB2Super conserved receptor expressed in brain 2

Background

GPR85 has been reported to be expressed in several areas of human and rat CNS Matsumoto et al., 2000), as well as in genital organs. ESTs have been isolated from B-cell/lung/testis, brain, testis, and embryo libraries, as well as many mouse tissue libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR85