GPR64 Antibody

Images

 
Immunohistochemistry-Paraffin: GPR64 Antibody [NBP1-84906] - Staining of human epididymis shows strong membranous and moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR64 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPTVSAPANVNTTSAPPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPNLAGEMINQVSRLLHSPPDMLAPLAQRLLKVVDDIGLQLNFSNTTISLTSPSLALAVIRVNASSFNTTTFVAQDPANLQVSLETQAPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR64
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR64 Protein (NBP1-84906PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR64 Antibody

  • EDDM6
  • epididymis-specific (seven transmembrane family)
  • G protein-coupled receptor 64
  • GPR64
  • HE6
  • MGC104454
  • MGC138738
  • TM7LN2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC-P
AF4634
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-52645
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, CyTOF-ready
NBP1-03561
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-48988
Species: Hu
Applications: IHC

Publications for GPR64 Antibody (NBP1-84906) (0)

There are no publications for GPR64 Antibody (NBP1-84906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR64 Antibody (NBP1-84906) (0)

There are no reviews for GPR64 Antibody (NBP1-84906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR64 Antibody (NBP1-84906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR64 Products

Bioinformatics Tool for GPR64 Antibody (NBP1-84906)

Discover related pathways, diseases and genes to GPR64 Antibody (NBP1-84906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR64 Antibody (NBP1-84906)

Discover more about diseases related to GPR64 Antibody (NBP1-84906).
 

Pathways for GPR64 Antibody (NBP1-84906)

View related products by pathway.

PTMs for GPR64 Antibody (NBP1-84906)

Learn more about PTMs related to GPR64 Antibody (NBP1-84906).
 

Research Areas for GPR64 Antibody (NBP1-84906)

Find related products by research area.

Blogs on GPR64

There are no specific blogs for GPR64, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR64 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR64
Entrez