GPR6 Antibody - BSA Free

Western Blot: GPR6 Antibody [NBP2-86658] - Host: Rabbit. Target Name: GPR6. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR6 Antibody - BSA Free (NBP2-86658) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GPR6. Peptide sequence: ATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR6 Antibody - BSA Free

• G protein-coupled receptor 6
• GPR6
• G-protein coupled receptor 6
• Sphingosine 1-phosphate receptor GPR6

Background

GPR6 has been identified as a constitutively active lysophospholipid/lysosphingolipid receptor. GPR6 has been reported to be expressed in brain, particularly in the putamen, and to a lesser extent, in the frontal cortex, hippocampus, and hypothalamus (Heiber et al., 1995). An EST has been isolated from a human brain (hypothalamus) library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR6