GPR45 Antibody - BSA Free

Western Blot: GPR45 Antibody [NBP3-09567] - Western blot analysis of GPR45 in RPMI-8226 Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR45 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR45 (NP_009158). Peptide sequence YVVTLVVAVFFAPFGVMLCAYMCILNTVRKNAVRVHNQSDSLDLRQLTRA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR45
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR45 Antibody - BSA Free

• G protein-coupled receptor 45
• GPR45
• high-affinity lysophosphatidic acid receptor
• probable G-protein coupled receptor 45
• PSP24
• PSP24(ALPHA)
• PSP24-1
• PSP24A
• PSP24-alpha

Background

GPR45 is an Orphan-A GPCR with an unknown ligand. It is the mammalian orthologue of a putative lysophosphatidic acid receptor from Xenopus laevis. GPR45 expression has been documented in human liver and brain, as well as in mouse brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR45