GPR34 Antibody

Images

 
Immunohistochemistry-Paraffin: GPR34 Antibody [NBP1-87583] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR34 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR34
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR34 Protein (NBP1-87583PEP)
Publications
Read Publication using NBP1-87583.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR34 Antibody

  • G protein-coupled receptor 34
  • GPR34
  • probable G-protein coupled receptor 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-83345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82438
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NB100-58974
Species: Hu, Bv, Mk, Pm, Rb
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-14197
Species: Hu
Applications: IHC, IHC-P

Publications for GPR34 Antibody (NBP1-87583)(1)

Reviews for GPR34 Antibody (NBP1-87583) (0)

There are no reviews for GPR34 Antibody (NBP1-87583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR34 Antibody (NBP1-87583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR34 Products

Bioinformatics Tool for GPR34 Antibody (NBP1-87583)

Discover related pathways, diseases and genes to GPR34 Antibody (NBP1-87583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR34 Antibody (NBP1-87583)

Discover more about diseases related to GPR34 Antibody (NBP1-87583).
 

Pathways for GPR34 Antibody (NBP1-87583)

View related products by pathway.

PTMs for GPR34 Antibody (NBP1-87583)

Learn more about PTMs related to GPR34 Antibody (NBP1-87583).
 

Research Areas for GPR34 Antibody (NBP1-87583)

Find related products by research area.

Blogs on GPR34

There are no specific blogs for GPR34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR34
Entrez