GPR21 Antibody

Images

 
Western Blot: GPR21 Antibody [NBP2-85013] - Host: Rabbit. Target Name: GPR21. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: GPR21 Antibody [NBP2-85013] - Rabbit Anti-GPR21 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Skeletal Muscle. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR21 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR21. Peptide sequence: FRICQQHTKDISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYIL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GPR21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR21 Antibody

  • G protein-coupled receptor 21
  • GPR21
  • probable G-protein coupled receptor 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DCP00
Species: Hu
Applications: ELISA
NLS1895
Species: Bt, Ha, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-55498
Species: Ca, Hu
Applications: IHC, IHC-Fr, IHC-P, WB
MAB8449
Species: Hu
Applications: CyTOF-ready, Flow
NLS1317
Species: Hu, Pm, Pm
Applications: Flow, IHC, IHC-P
NBP2-85013
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GPR21 Antibody (NBP2-85013) (0)

There are no publications for GPR21 Antibody (NBP2-85013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR21 Antibody (NBP2-85013) (0)

There are no reviews for GPR21 Antibody (NBP2-85013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR21 Antibody (NBP2-85013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR21 Products

Array NBP2-85013

Bioinformatics Tool for GPR21 Antibody (NBP2-85013)

Discover related pathways, diseases and genes to GPR21 Antibody (NBP2-85013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR21 Antibody (NBP2-85013)

Discover more about diseases related to GPR21 Antibody (NBP2-85013).
 

Pathways for GPR21 Antibody (NBP2-85013)

View related products by pathway.

Research Areas for GPR21 Antibody (NBP2-85013)

Find related products by research area.

Blogs on GPR21

There are no specific blogs for GPR21, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR21