GPR19 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of GPR19. Peptide sequence: LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR19 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GPR19 Antibody - BSA Free
Background
GPR19 is an Orphan-A GPCR with an unknown ligand. GPR19 has been reported in human in regions overlapping with the dopamine D2 receptor expression in the brain and peripheral nervous system. ESTs have been isolated from human brain, nerve, and germ-cell tumor libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for GPR19 Antibody (NBP2-87523) (0)
There are no publications for GPR19 Antibody (NBP2-87523).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR19 Antibody (NBP2-87523) (0)
There are no reviews for GPR19 Antibody (NBP2-87523).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPR19 Antibody (NBP2-87523) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR19 Products
Research Areas for GPR19 Antibody (NBP2-87523)
Find related products by research area.
|
Blogs on GPR19