GPR160 Antibody


Western Blot: GPR160 Antibody [NBP3-09486] - Western blot analysis of GPR160 in Fetal Liver as a positive control. Antibody dilution at 1.0 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GPR160 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR160 (NP_055188). Peptide sequence ILTLGMRRKNTCQNFMEYFCISLAFVDLLLLVNISIILYFRDFVLLSIRF
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for GPR160 Antibody

  • G protein-coupled receptor 160
  • GPCR150GPCR1
  • GPR160
  • G-protein coupled receptor GPCR1
  • hGPCR1
  • probable G-protein coupled receptor 160
  • putative G protein-coupled receptor


GPCR150 is an Orphan-A GPCR with an unknown ligand. ESTs for GPCR150 have been isolated from a diverse set of human tissue libraries, including normal small intestine, kidney, skeletal muscle and tonsil, and cancerous blood, bladder, placenta and parathyroid.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for GPR160 Antibody (NBP3-09486) (0)

There are no publications for GPR160 Antibody (NBP3-09486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR160 Antibody (NBP3-09486) (0)

There are no reviews for GPR160 Antibody (NBP3-09486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR160 Antibody (NBP3-09486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPR160 Products

Bioinformatics Tool for GPR160 Antibody (NBP3-09486)

Discover related pathways, diseases and genes to GPR160 Antibody (NBP3-09486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR160 Antibody (NBP3-09486)

Discover more about diseases related to GPR160 Antibody (NBP3-09486).

Pathways for GPR160 Antibody (NBP3-09486)

View related products by pathway.

PTMs for GPR160 Antibody (NBP3-09486)

Learn more about PTMs related to GPR160 Antibody (NBP3-09486).

Research Areas for GPR160 Antibody (NBP3-09486)

Find related products by research area.

Blogs on GPR160

There are no specific blogs for GPR160, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPR160 Antibody and receive a gift card or discount.


Gene Symbol GPR160