GPR139 Antibody

Images

 
Immunohistochemistry: GPR139 Antibody [NBP2-48850] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR139 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK
Specificity
Specificity of human GPR139 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR139
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR139 Recombinant Protein Antigen (NBP2-48850PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR139 Antibody

  • G protein-coupled receptor 139
  • G(q)-coupled orphan receptor GPRg1
  • GPR139
  • GPRg1
  • G-protein-coupled receptor PGR3
  • PGR3
  • PGR3G protein-coupled receptor PGR3
  • probable G-protein coupled receptor 139

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS442
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
NBP1-84903
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00442206-R02
Species: Hu
NBP1-02393
Species: Hu
Applications: IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87284
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13701
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-68209
Species: Hu
Applications: WB, IP, PLA

Publications for GPR139 Antibody (NBP2-48850) (0)

There are no publications for GPR139 Antibody (NBP2-48850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR139 Antibody (NBP2-48850) (0)

There are no reviews for GPR139 Antibody (NBP2-48850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR139 Antibody (NBP2-48850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GPR139 Antibody (NBP2-48850)

Discover related pathways, diseases and genes to GPR139 Antibody (NBP2-48850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR139 Antibody (NBP2-48850)

Discover more about diseases related to GPR139 Antibody (NBP2-48850).

Research Areas for GPR139 Antibody (NBP2-48850)

Find related products by research area.

Blogs on GPR139

There are no specific blogs for GPR139, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR139 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR139
Entrez