Recombinant Human GPR12 Protein

Images

 
SDS-Page: Recombinant Human GPR12 Protein [H00002835-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GPR12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-334 of Human GPR12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GPR12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR12 Protein

  • FLJ18149
  • FLJ97704
  • G protein-coupled receptor 12
  • GPCR12
  • GPCR21
  • GPR12
  • G-protein coupled receptor 12
  • MGC138349
  • MGC138351

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41102
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS1194
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NLS418
Species: Hu
Applications: IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS145
Species: Hu, Ca, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
H00002835-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GPR12 Recombinant Protein (H00002835-P01) (0)

There are no publications for GPR12 Recombinant Protein (H00002835-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR12 Recombinant Protein (H00002835-P01) (0)

There are no reviews for GPR12 Recombinant Protein (H00002835-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR12 Recombinant Protein (H00002835-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR12 Products

Bioinformatics Tool for GPR12 Recombinant Protein (H00002835-P01)

Discover related pathways, diseases and genes to GPR12 Recombinant Protein (H00002835-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR12 Recombinant Protein (H00002835-P01)

Discover more about diseases related to GPR12 Recombinant Protein (H00002835-P01).
 

Pathways for GPR12 Recombinant Protein (H00002835-P01)

View related products by pathway.

PTMs for GPR12 Recombinant Protein (H00002835-P01)

Learn more about PTMs related to GPR12 Recombinant Protein (H00002835-P01).
 

Research Areas for GPR12 Recombinant Protein (H00002835-P01)

Find related products by research area.

Blogs on GPR12

There are no specific blogs for GPR12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APC Antibody
NB100-91662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPR12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR12
Entrez