Recombinant Human GPR12 GST (N-Term) Protein

SDS-Page: Recombinant Human GPR12 Protein [H00002835-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human GPR12 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-334 of Human GPR12
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: GPR12
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 63.1 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR12 GST (N-Term) Protein

• FLJ18149
• FLJ97704
• G protein-coupled receptor 12
• GPCR12
• GPCR21
• GPR12
• G-protein coupled receptor 12
• MGC138349
• MGC138351

Background

GPCR GPR12 is a G protein coupled receptor. A variety of extracellular signals are transmitted into cells through integral membrane receptors coupled to heterotrimeric G proteins. Such G protein coupled receptors are critical for the normal functions of many cell types: neurons, endocrine cells, cardiac and smooth muscle cells, and sensory cells for detection of light, taste, and smell. Both activating and loss of function mutations in G protein coupled receptors have been found as the cause of human diseases. The GPR12 gene is located on human chromosome 13q12. GPR12 expression has been reported primarily in the central nervous system. Rat transcripts have been identified at low levels in testis and pituitary gland. ESTs have been isolated from human brain and eye libraries, as well as mouse brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GPR12