GPR107 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR107 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500-1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GPR107 Antibody - BSA Free
Background
The GPR107 gene encodes protein GPR107 that in isoform 1 is 600 amino acids long, 66 kDA, in isoform 2 is 552 amino acids long, 61 KDA, and in isoform 3 is 300 amino acids long, 33 kDA. GPR107 is known to interact with the gene UBC. It has been researched regarding its role in nail-patella syndrome, basal cell carcinoma, spina bifida, and focal dermal hypoplasia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, IHC
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Publications for GPR107 Antibody (NBP1-83629) (0)
There are no publications for GPR107 Antibody (NBP1-83629).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR107 Antibody (NBP1-83629) (0)
There are no reviews for GPR107 Antibody (NBP1-83629).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GPR107 Antibody (NBP1-83629) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR107 Products
Research Areas for GPR107 Antibody (NBP1-83629)
Find related products by research area.
|
Blogs on GPR107