Recombinant Human GlyT2/SLC6A5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GlyT2/SLC6A5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 294-393 of Human SLC6A5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR

Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC6A5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GlyT2/SLC6A5 Protein

  • Glycine Transporter-2
  • GlyT2
  • GLYT-2
  • GLYT2GlyT-2
  • HKPX3
  • NET1
  • SLC6A5
  • sodium- and chloride-dependent glycine transporter 2
  • solute carrier family 6 (neurotransmitter transporter, glycine), member 5
  • Solute carrier family 6 member 5

Background

SLC6A5 - solute carrier family 6 (neurotransmitter transporter, glycine), member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81827
Species: Hu
Applications: WB, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-46628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-113
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7848
Species: Hu
Applications: WB, IHC
NBP2-30683
Species: Hu
Applications: IHC, IHC-P
NBP2-46641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC

Publications for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01) (0)

There are no publications for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01) (0)

There are no reviews for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GlyT2/SLC6A5 Products

Bioinformatics Tool for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01)

Discover related pathways, diseases and genes to GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01)

Discover more about diseases related to GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01).
 

Pathways for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01)

View related products by pathway.

PTMs for GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01)

Learn more about PTMs related to GlyT2/SLC6A5 Partial Recombinant Protein (H00009152-Q01).

Blogs on GlyT2/SLC6A5

There are no specific blogs for GlyT2/SLC6A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RhoA Antibody
NB100-91273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GlyT2/SLC6A5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A5
Entrez