We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Glycophorin C Recombinant Protein Antigen

Images

 
There are currently no images for Glycophorin C Protein (NBP1-84597PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glycophorin C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GYPC.

Source: E. coli

Amino Acid Sequence: RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GYPC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84597.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glycophorin C Recombinant Protein Antigen

  • CD236 antigen
  • CD236
  • CD236R
  • GE
  • GLPC
  • glycoconnectin
  • glycophorin C (Gerbich blood group)
  • glycophorin-C
  • glycophorin-D
  • Glycoprotein beta
  • GPCMGC126191
  • GPD
  • GYPD
  • MGC117309
  • MGC126192
  • PAS-2
  • PAS-2'
  • Sialoglycoprotein D

Background

Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, butplays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations havebeen described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duchantigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin Cprotein has very little homology with glycophorins A and B. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7770-GT
Species: Hu
Applications: EnzAct
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
MAB7265
Species: Mu
Applications: IHC, WB
NBP3-15385
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB500-526
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-31225
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00025861-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PLA, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for Glycophorin C Protein (NBP1-84597PEP) (0)

There are no publications for Glycophorin C Protein (NBP1-84597PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycophorin C Protein (NBP1-84597PEP) (0)

There are no reviews for Glycophorin C Protein (NBP1-84597PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glycophorin C Protein (NBP1-84597PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glycophorin C Products

Research Areas for Glycophorin C Protein (NBP1-84597PEP)

Find related products by research area.

Blogs on Glycophorin C

There are no specific blogs for Glycophorin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glycophorin C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GYPC