Recombinant Human GLIPR1L2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GLIPR1L2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 253 of Human GLIPR1L2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GLIPR1L2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GLIPR1L2 Protein

  • GLI pathogenesis-related 1 like 2
  • GLIPR1-like protein 2
  • MGC39497

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82722
Species: Hu
Applications: IHC, IHC-P
AF4468
Species: Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF6386
Species: Hu
Applications: WB, IP
NBL1-14964
Species: Hu
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP

Publications for GLIPR1L2 Recombinant Protein (H00144321-P01) (0)

There are no publications for GLIPR1L2 Recombinant Protein (H00144321-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLIPR1L2 Recombinant Protein (H00144321-P01) (0)

There are no reviews for GLIPR1L2 Recombinant Protein (H00144321-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLIPR1L2 Recombinant Protein (H00144321-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLIPR1L2 Products

Bioinformatics Tool for GLIPR1L2 Recombinant Protein (H00144321-P01)

Discover related pathways, diseases and genes to GLIPR1L2 Recombinant Protein (H00144321-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLIPR1L2 Recombinant Protein (H00144321-P01)

Discover more about diseases related to GLIPR1L2 Recombinant Protein (H00144321-P01).
 

Pathways for GLIPR1L2 Recombinant Protein (H00144321-P01)

View related products by pathway.

PTMs for GLIPR1L2 Recombinant Protein (H00144321-P01)

Learn more about PTMs related to GLIPR1L2 Recombinant Protein (H00144321-P01).

Blogs on GLIPR1L2

There are no specific blogs for GLIPR1L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GLIPR1L2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GLIPR1L2