GJC3 Antibody

Western Blot: GJC3 Antibody [NBP2-87500] - WB Suggested Anti-Gje1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Mouse Spleen

Product Discontinued

GJC3 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse GJC3. Peptide sequence: GFRLLILVSSGPGVFGNDENEFICHLGQPGCKTICYDVFRPLSPLRFWAF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GJC3 Antibody

• connexin 29
• connexin-30.2
• Connexin-31.3
• CX29
• Cx30.2
• CX30.2connexin-31.3
• CX31.3
• Gap junction epsilon-1 protein
• gap junction gamma-3 protein
• gap junction protein, epsilon 1, 29kDa
• gap junction protein, gamma 3, 30.2kDa
• GJE1

Background

Connexins, such as GJC3, are involved in the formation of gap junctions, intercellular conduits that directly connectthe cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of whichcontains 6 connexin subunits (Sohl et al., 2003 (PubMed 12881038)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJC3