GJC3 Antibody Summary
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse GJC3. Peptide sequence: GFRLLILVSSGPGVFGNDENEFICHLGQPGCKTICYDVFRPLSPLRFWAF The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GJC3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GJC3 Antibody
Background
Connexins, such as GJC3, are involved in the formation of gap junctions, intercellular conduits that directly connectthe cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of whichcontains 6 connexin subunits (Sohl et al., 2003 (PubMed 12881038)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Rt
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Publications for GJC3 Antibody (NBP2-87500) (0)
There are no publications for GJC3 Antibody (NBP2-87500).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GJC3 Antibody (NBP2-87500) (0)
There are no reviews for GJC3 Antibody (NBP2-87500).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GJC3 Antibody (NBP2-87500) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GJC3 Products
Blogs on GJC3