Home » GIMAP4 » GIMAP4 Antibodies » GIMAP4 Antibody (1D8)

GIMAP4 Antibody (1D8)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: GIMAP4 Antibody (1D8) [H00055303-M05] - Detection limit for recombinant GST tagged GIMAP4 is 0.1 ng/ml as a capture antibody.
Sandwich ELISA: GIMAP4 Antibody (1D8) [H00055303-M05] - Detection limit for recombinant GST tagged GIMAP4 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GIMAP4 Antibody (1D8) Summary

Immunogen
GIMAP4 (NP_060796, 125 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYTEEEHKATEKILKMFGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNR
Specificity
GIMAP4 - GTPase, IMAP family member 4 (1D8)
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
GIMAP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GIMAP4 Antibody (1D8)

  • GTPase IMAP family member 4
  • GTPase, IMAP family member 4
  • HIMAP4
  • human immune associated nucleotide 1
  • IAN-1
  • IAN1FLJ11110
  • IMAP4hIAN1
  • immunity associated protein 4
  • Immunity-associated nucleotide 1 protein
  • Immunity-associated protein 4

Background

This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia 1 (TAL1). In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GIMAP5 Antibody
NBP1-31165
Western Blot: GIMAP5 Antibody [NBP1-31165] - Sample (30 ug of whole cell lysate)A: HeLa S3 12% SDS PAGE, antibody diluted at 1:500.
Immunohistochemistry-Paraffin: GIMAP5 Antibody [NBP1-31165] - Paraffin-embedded breast cancer. GIMAP5 antibody dilution: 1:250.
Species: Hu
Applications: WB, IHC, IHC-P
Lyp/PTPN22
Antibody (340113)
MAB3428
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Daudi human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Lyp Monoclonal Antibody (Catalog # MAB3428) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Lyp at approximately 108 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lyp was detected in immersion fixed paraffin-embedded sections of human lymph node using 25 µg/mL Mouse Anti-Human Lyp Monoclonal Antibody (Catalog # MAB3428) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC
HLA DQW1 Antibody
(Genox 3.53)
NB100-2702
Flow Cytometry: HLA DQW1 Antibody (Genox 3.53) [NB100-2702] - Human lymphoblastoid cell lines. Image from verified customer review. Analysis using the Alexa Fluor (R) 647 conjugated antibody.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
SCL/Tal1 Antibody
NBP1-33757
Western Blot: SCL/Tal1 Antibody [NBP1-33757] - Sample (30 ug of whole cell lysate) A: H1299 10% SDS PAGE; antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: SCL/Tal1 Antibody [NBP1-33757] - Paraffin-embedded mouse spleen dilution: 1:500.
Immunohistochemistry-Paraffin: SCL/Tal1 Antibody [NBP1-33757] - Paraffin-embedded A549 Xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry: CD8 Antibody (53-6.7) [NBP1-49045] - Histopathological analysis of spinal cord in EAE mice. Representative spinal cord sections from wild-type (WT), Asic1-/-, and Asic2-/- mice at 45 days after immunization. Sections of the spinal cord anterior horn were stained with hematoxylin and eosin (E&H) to assess inflammation and immunostained for MCHII, CD4+, CD8+ infiltrating cells. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/ejn.14302), licensed under a CC-BY licence.
Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PTGDR Antibody
H00005729-B01P
Western Blot: PTGDR Antibody [H00005729-B01P] - Analysis of PTGDR expression in transfected 293T cell line by PTGDR polyclonal antibody. Lane 1: PTGDR transfected lysate(39.6 KDa). Lane 2: Non-transfected lysate.
Flow Cytometry: PTGDR Antibody [H00005729-B01P] - Analysis of negative control 293 cells (Black) and PTGDR expressing 293 cells (Green) using PTGDR purified mouse polyclonal antibody.
(2 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF
Desmoplakin
Antibody
NBP1-49879
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP1-49879] - Paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
GIMAP8 Antibody
NBP1-85059
Western Blot: GIMAP8 Antibody [NBP1-85059] - Analysis in control (vector only transfected HEK293T lysate) and GIMAP8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: GIMAP8 Antibody [NBP1-85059] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.
Species: Hu
Applications: WB, IHC, IHC-P
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - Analysis of SH2D1A expression in transfected 293T cell line by SH2D1A monoclonal antibody (M01), clone 1C9.Lane 1: SH2D1A transfected lysate(14.2 KDa).Lane 2: Non-transfected lysate.
Flow Cytometry: SH2D1A Antibody (1C9) [H00004068-M01] - Intracellular staining of human T cells with SH2D1A monoclonal antibody or isotype control antibody, followed by a Polyclonal Goat Anti-Mouse/RPE secondary antibody. Grey filled histogram: Isotype control, empty blue histogram: SH2D1A antibody. Flow cytometry image submitted by a verified customer review.
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - SH2D1A monoclonal antibody (M01), clone 1C9 Analysis of SH2D1A expression in Jurkat.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA
Calmodulin 2
Antibody
NBP2-14871
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Sample (50 ug of whole cell lysate) A: Mouse brain 15% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
(1 Publication)
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu

Publications for GIMAP4 Antibody (H00055303-M05) (0)

There are no publications for GIMAP4 Antibody (H00055303-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIMAP4 Antibody (H00055303-M05) (0)

There are no reviews for GIMAP4 Antibody (H00055303-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIMAP4 Antibody (H00055303-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional GIMAP4 Products

Bioinformatics Tool for GIMAP4 Antibody (H00055303-M05)

Discover related pathways, diseases and genes to GIMAP4 Antibody (H00055303-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIMAP4 Antibody (H00055303-M05)

Discover more about diseases related to GIMAP4 Antibody (H00055303-M05).
 

Pathways for GIMAP4 Antibody (H00055303-M05)

View related products by pathway.

PTMs for GIMAP4 Antibody (H00055303-M05)

Learn more about PTMs related to GIMAP4 Antibody (H00055303-M05).

Blogs on GIMAP4

There are no specific blogs for GIMAP4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIMAP4 Antibody (1D8) and receive a gift card or discount.


Bioinformatics

Gene Symbol GIMAP4
Entrez
Uniprot