GIMAP1 Antibody

Images

 
Western Blot: GIMAP1 Antibody [NBP1-91940] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: GIMAP1 Antibody [NBP1-91940] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GIMAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GIMAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GIMAP1 Protein (NBP1-91940PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GIMAP1 Antibody

  • GTPase IMAP family member 1
  • GTPase, IMAP family member 1
  • HIMAP1
  • IMAP1immunity associated protein 1
  • IMAP38
  • Immunity-associated protein 1

Background

GIMAP1 encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31165
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-03730
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
MAB9080
Species: Hu
Applications: WB
G-125-C
Species: Hu
Applications:
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
H00006775-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-41166
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
7625
Species: Mu
Applications: ELISA
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for GIMAP1 Antibody (NBP1-91940) (0)

There are no publications for GIMAP1 Antibody (NBP1-91940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIMAP1 Antibody (NBP1-91940) (0)

There are no reviews for GIMAP1 Antibody (NBP1-91940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIMAP1 Antibody (NBP1-91940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GIMAP1 Products

Bioinformatics Tool for GIMAP1 Antibody (NBP1-91940)

Discover related pathways, diseases and genes to GIMAP1 Antibody (NBP1-91940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIMAP1 Antibody (NBP1-91940)

Discover more about diseases related to GIMAP1 Antibody (NBP1-91940).
 

Pathways for GIMAP1 Antibody (NBP1-91940)

View related products by pathway.

Blogs on GIMAP1

There are no specific blogs for GIMAP1, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIMAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GIMAP1