Novus Biologicals products are now on bio-techne.com

Gigaxonin Antibody (4G7)

Images

 
Immunocytochemistry/ Immunofluorescence: Gigaxonin Antibody (4G7) [H00008139-M01] - Analysis of monoclonal antibody to GAN on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: Gigaxonin Antibody (4G7) [H00008139-M01] - Detection limit for recombinant GST tagged GAN is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Gigaxonin Antibody (4G7) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
GAN (NP_071324, 534 a.a. ~ 597 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP
Specificity
GAN - giant axonal neuropathy (gigaxonin) (4G7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GAN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gigaxonin Antibody (4G7)

  • FLJ38059
  • GAN1KLHL16Kelch-like protein 16
  • giant axonal neuropathy (gigaxonin)
  • gigaxonin

Background

This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. (Kelch repeats are predicted to form a beta-propeller shape.) The encoded protein plays a role in neurofilament architecture and is mutated in giant axonal neuropathy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-42827
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-80913
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
H00008898-M03
Species: Hu, Rt
Applications: ELISA, WB
NBP1-84430
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1268
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-47281
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NBP2-13283
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46321
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for Gigaxonin Antibody (H00008139-M01) (0)

There are no publications for Gigaxonin Antibody (H00008139-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gigaxonin Antibody (H00008139-M01) (0)

There are no reviews for Gigaxonin Antibody (H00008139-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gigaxonin Antibody (H00008139-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gigaxonin Antibody (4G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GAN
Entrez
Uniprot