GGT5 Recombinant Protein Antigen

Images

 
There are currently no images for GGT5 Protein (NBP1-81833PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GGT5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GGT5.

Source: E.coli

Amino Acid Sequence: GTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GGT5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81833.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GGT5 Recombinant Protein Antigen

  • DKFZp566O011
  • EC 2.3.2.2
  • gamma-glutamyl cleaving enzyme
  • Gamma-glutamyl transpeptidase-related enzyme
  • gamma-glutamyl transpeptidase-related protein
  • gamma-glutamyltransferase 5
  • Gamma-glutamyltransferase-like activity 1FLJ92733
  • Gamma-glutamyltranspeptidase 5
  • GGT 5
  • GGT5
  • GGTLA1
  • GGT-rel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-56928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-81882
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84319
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34099
Species: Hu
Applications: IHC, IHC-P
AF5129
Species: Hu
Applications: WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-76801
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
NBP1-81833PEP
Species: Hu
Applications: AC

Publications for GGT5 Protein (NBP1-81833PEP) (0)

There are no publications for GGT5 Protein (NBP1-81833PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGT5 Protein (NBP1-81833PEP) (0)

There are no reviews for GGT5 Protein (NBP1-81833PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GGT5 Protein (NBP1-81833PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GGT5 Protein (NBP1-81833PEP)

Discover related pathways, diseases and genes to GGT5 Protein (NBP1-81833PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGT5 Protein (NBP1-81833PEP)

Discover more about diseases related to GGT5 Protein (NBP1-81833PEP).

Blogs on GGT5

There are no specific blogs for GGT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GGT5 Antibody
NBP1-81833

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GGT5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GGT5