GFRAL Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCD LKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GFRAL |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200-1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for GFRAL Antibody
Background
The GFRAL gene encodes a 394 amino acid long, 44 kDA GDNF family receptor alpha-like that is known to interact with the SIRT5 gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind, BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Bind, BA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for GFRAL Antibody (NBP2-14046) (0)
There are no publications for GFRAL Antibody (NBP2-14046).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GFRAL Antibody (NBP2-14046) (0)
There are no reviews for GFRAL Antibody (NBP2-14046).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GFRAL Antibody (NBP2-14046) (0)
Secondary Antibodies
| |
Isotype Controls
|
Blogs on GFRAL