GFRAL Antibody

Images

 
Immunohistochemistry-Paraffin: GFRAL Antibody [NBP2-14046] Staining of human kidney shows strong membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GFRAL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCD LKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GFRAL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GFRAL Protein (NBP2-14046PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GFRAL Antibody

  • bA360D14.1
  • C6orf144
  • GDNF family receptor alpha like
  • GRAL
  • UNQ9356

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: WB, IHC
MAB2388
Species: Hu
Applications: WB, IHC
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-33169
Species: Hu, Mu
Applications: WB
AF2645
Species: Mu
Applications: WB, IHC
AF1085
Species: Mu
Applications: WB, IHC, Neut
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00004802-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF4715
Species: Mu
Applications: WB
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA

Publications for GFRAL Antibody (NBP2-14046) (0)

There are no publications for GFRAL Antibody (NBP2-14046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFRAL Antibody (NBP2-14046) (0)

There are no reviews for GFRAL Antibody (NBP2-14046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GFRAL Antibody (NBP2-14046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFRAL Products

Bioinformatics Tool for GFRAL Antibody (NBP2-14046)

Discover related pathways, diseases and genes to GFRAL Antibody (NBP2-14046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFRAL Antibody (NBP2-14046)

Discover more about diseases related to GFRAL Antibody (NBP2-14046).

Blogs on GFRAL

There are no specific blogs for GFRAL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFRAL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GFRAL