GFR alpha-like Antibody - BSA Free

Western Blot: GFR alpha-like Antibody [NBP3-09606] - Western blot analysis of GFR alpha-like in Hela Whole cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GFR alpha-like Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GFR alpha-like (NP_997293). Peptide sequence TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GFRAL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GFR alpha-like Antibody - BSA Free

• bA360D14.1
• C6orf144
• GDNF family receptor alpha-like
• GFR alpha like
• GFR alpha-like
• GFRAL
• GRAL
• IVFI9356
• UNQ9356

Background

Enables glial cell-derived neurotrophic factor receptor activity and receptor tyrosine kinase binding activity. Involved in glial cell-derived neurotrophic factor receptor signaling pathway; positive regulation of MAPK cascade; and positive regulation of protein kinase B signaling. Located in external side of plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GFRAL