We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GCAP3 Recombinant Protein Antigen

Images

 
There are currently no images for GCAP3 Protein (NBP1-91930PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GCAP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GUCA1C.

Source: E. coli

Amino Acid Sequence: GNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GUCA1C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91930.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GCAP3 Recombinant Protein Antigen

  • GCAP3GCAP 3
  • guanylate cyclase activator 1CMGC120159
  • guanylyl cyclase-activating protein 3
  • MGC120158

Background

GCAP3, also known as GUCA1C or Guanylyl cyclase-activating protein 3, has a 209 amino acid isoform that is 24 kDa and a short 196 amino acid isoform that is approx. 22 kDa; commonly found in retina; in conditions of low free calcium ions concentration stimulates guanylyl cyclase 1 (GC1) and GC2 and when the concentration is elevated inhibits guanylyl cyclases, which is very important for the recuperation of the dark state of rod photoreceptors following light exposure. Disease research has linked this protein with cone dystrophy, neuronitis, and retinitis. This protein has shown interactions with GUCA1A, GUCA1B, GUCY2D, GUCY2F, and CNGA3 proteins in the pathways such as the visual cycle in retinal rods, olfactory transduction, and phototransduction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55158
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P
NBP2-68721
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
H00000251-M07
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, KD, ELISA(Cap), S-ELISA, WB
NBP1-84880
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-06415
Species: Hu
Applications: ELISA, Flow
NBP3-17540
Species: Hu
Applications: ICC/IF, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-33897
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-38258
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-58940
Species: Hu
Applications: ICC/IF, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-97491
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-91930PEP
Species: Hu
Applications: AC

Publications for GCAP3 Protein (NBP1-91930PEP) (0)

There are no publications for GCAP3 Protein (NBP1-91930PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCAP3 Protein (NBP1-91930PEP) (0)

There are no reviews for GCAP3 Protein (NBP1-91930PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GCAP3 Protein (NBP1-91930PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GCAP3 Products

Blogs on GCAP3

There are no specific blogs for GCAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GCAP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCA1C