GBP7 Antibody

Images

 
Immunohistochemistry-Paraffin: GBP7 Antibody [NBP2-14731] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GBP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLN EEINRLKEQIEAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GBP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GBP7 Protein (NBP2-14731PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GBP7 Antibody

  • GBP4L
  • GBP7 guanylate binding protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03972
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77158
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-84117
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GBP7 Antibody (NBP2-14731) (0)

There are no publications for GBP7 Antibody (NBP2-14731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBP7 Antibody (NBP2-14731) (0)

There are no reviews for GBP7 Antibody (NBP2-14731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GBP7 Antibody (NBP2-14731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBP7 Products

GBP7 NBP2-14731

Bioinformatics Tool for GBP7 Antibody (NBP2-14731)

Discover related pathways, diseases and genes to GBP7 Antibody (NBP2-14731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBP7 Antibody (NBP2-14731)

Discover more about diseases related to GBP7 Antibody (NBP2-14731).
 

Pathways for GBP7 Antibody (NBP2-14731)

View related products by pathway.

Blogs on GBP7

There are no specific blogs for GBP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GBP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GBP7