Gamma Adaptin Antibody - BSA Free

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Brain lysate, concentration 0.2-1 ug/ml.

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml AP1G1 is supported by BioGPS gene expression data to be expressed in HepG2.

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Jurkat, Antibody Dilution: 1.0 ug/ml AP1G1 is supported by BioGPS gene expression data to be expressed in Jurkat.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Gamma Adaptin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to AP1G1(adaptor-related protein complex 1, gamma 1 subunit) The peptide sequence was selected from the C terminal of AP1G1. Peptide sequence DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP1G1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Gamma Adaptin Antibody - BSA Free

• Adapter-related protein complex 1 subunit gamma-1
• Adaptor protein complex AP-1 subunit gamma-1
• adaptor-related protein complex 1, gamma 1 subunit
• ADTGclathrin assembly protein complex 1 gamma large chain
• AP-1 complex subunit gamma-1
• CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1
• Clathrin assembly protein complex 1 gamma-1 large chain
• gamma adaptin
• gamma1-adaptin
• golgi adaptor HA1/AP1 adaptin gamma subunit
• Golgi adaptor HA1/AP1 adaptin subunit gamma-1
• MGC18255

Background

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP1G1
• Uniprot:
  • O43747(Human)