Gamma Adaptin Antibody

Images

 
Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml AP1G1 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Jurkat, Antibody Dilution: 1.0 ug/ml AP1G1 is supported by BioGPS gene expression data to be expressed in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gamma Adaptin Antibody Summary

Immunogen
Synthetic peptides corresponding to AP1G1(adaptor-related protein complex 1, gamma 1 subunit) The peptide sequence was selected from the C terminal of AP1G1. Peptide sequence DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP1G1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AP1G1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Gamma Adaptin Antibody

  • Adapter-related protein complex 1 subunit gamma-1
  • Adaptor protein complex AP-1 subunit gamma-1
  • adaptor-related protein complex 1, gamma 1 subunit
  • ADTGclathrin assembly protein complex 1 gamma large chain
  • AP-1 complex subunit gamma-1
  • CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1
  • Clathrin assembly protein complex 1 gamma-1 large chain
  • gamma adaptin
  • gamma1-adaptin
  • golgi adaptor HA1/AP1 adaptin gamma subunit
  • Golgi adaptor HA1/AP1 adaptin subunit gamma-1
  • MGC18255

Background

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81857
Species: Hu
Applications: WB, IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14047
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90879
Species: Hu
Applications: IHC, IHC-P
NBP1-82745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-58645
Species: Hu
Applications: WB, ICC/IF

Publications for Gamma Adaptin Antibody (NBP1-57633) (0)

There are no publications for Gamma Adaptin Antibody (NBP1-57633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gamma Adaptin Antibody (NBP1-57633) (0)

There are no reviews for Gamma Adaptin Antibody (NBP1-57633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gamma Adaptin Antibody (NBP1-57633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gamma Adaptin Products

Bioinformatics Tool for Gamma Adaptin Antibody (NBP1-57633)

Discover related pathways, diseases and genes to Gamma Adaptin Antibody (NBP1-57633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Gamma Adaptin Antibody (NBP1-57633)

Find related products by research area.

Blogs on Gamma Adaptin

There are no specific blogs for Gamma Adaptin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gamma Adaptin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1G1
Uniprot