GAL3ST3 Antibody


Western Blot: GAL3ST3 Antibody [NBP1-69307] - This Anti-GAL3ST3 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GAL3ST3 Antibody Summary

Synthetic peptides corresponding to GAL3ST3(galactose-3-O-sulfotransferase 3) The peptide sequence was selected from the C terminal of GAL3ST3. Peptide sequence VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GAL3ST3 and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GAL3ST3 Antibody

  • Beta-galactose-3-O-sulfotransferase 3
  • EC 2.8.2.-
  • GAL3ST2galactose 3'-sulfotransferase
  • Gal3ST3
  • GAL3ST-3
  • galactose-3-O-sulfotransferase 3
  • Gal-beta-1, 3-GalNAc 3'-sulfotransferase 3
  • galbeta1-3GalNAc 3'-sulfotransferase 3
  • MGC142112
  • MGC142114


GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene, which has also been referred to as GAL3ST2, is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene, which has also been referred to as GAL3ST2, is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, Flow-IC
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for GAL3ST3 Antibody (NBP1-69307) (0)

There are no publications for GAL3ST3 Antibody (NBP1-69307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAL3ST3 Antibody (NBP1-69307) (0)

There are no reviews for GAL3ST3 Antibody (NBP1-69307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAL3ST3 Antibody (NBP1-69307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GAL3ST3 Products

GAL3ST3 NBP1-69307

Bioinformatics Tool for GAL3ST3 Antibody (NBP1-69307)

Discover related pathways, diseases and genes to GAL3ST3 Antibody (NBP1-69307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAL3ST3 Antibody (NBP1-69307)

Discover more about diseases related to GAL3ST3 Antibody (NBP1-69307).

Research Areas for GAL3ST3 Antibody (NBP1-69307)

Find related products by research area.

Blogs on GAL3ST3

There are no specific blogs for GAL3ST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GAL3ST3 Antibody and receive a gift card or discount.


Gene Symbol GAL3ST3