We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GAL3ST3 Antibody - BSA Free

Images

 
Western Blot: GAL3ST3 Antibody [NBP1-69307] - This Anti-GAL3ST3 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related GAL3ST3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69307
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GAL3ST3 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to GAL3ST3(galactose-3-O-sulfotransferase 3) The peptide sequence was selected from the C terminal of GAL3ST3. Peptide sequence VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAL3ST3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GAL3ST3 Antibody - BSA Free

  • Beta-galactose-3-O-sulfotransferase 3
  • EC 2.8.2.-
  • GAL3ST2galactose 3'-sulfotransferase
  • Gal3ST3
  • GAL3ST-3
  • galactose-3-O-sulfotransferase 3
  • Gal-beta-1, 3-GalNAc 3'-sulfotransferase 3
  • galbeta1-3GalNAc 3'-sulfotransferase 3
  • MGC142112
  • MGC142114

Background

GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene, which has also been referred to as GAL3ST2, is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene, which has also been referred to as GAL3ST2, is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16522
Species: Hu, Mu, Rt
Applications: WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-24787
Species: Ca, Hu, Mu
Applications: DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-32822
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DY413
Species: Mu
Applications: ELISA
NBP2-13390
Species: Hu
Applications: IHC,  IHC-P
AF5446
Species: Hu
Applications: IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
DTFF30
Species: Hu
Applications: ELISA
AF5316
Species: Hu
Applications: WB
NBP1-69307
Species: Hu
Applications: WB

Publications for GAL3ST3 Antibody (NBP1-69307) (0)

There are no publications for GAL3ST3 Antibody (NBP1-69307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAL3ST3 Antibody (NBP1-69307) (0)

There are no reviews for GAL3ST3 Antibody (NBP1-69307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAL3ST3 Antibody (NBP1-69307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAL3ST3 Products

Array NBP1-69307

Research Areas for GAL3ST3 Antibody (NBP1-69307)

Find related products by research area.

Blogs on GAL3ST3

There are no specific blogs for GAL3ST3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAL3ST3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GAL3ST3
Uniprot