GAGE1 Antibody

Images

 
Western Blot: GAGE1 Antibody [H00002543-B01P] - Analysis of GAGE1 expression in transfected 293T cell line by GAGE1 polyclonal antibody. Lane 1: GAGE1 transfected lysate(15.29 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: GAGE1 Antibody [H00002543-B01P] - Analysis of purified antibody to GAGE1 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GAGE1 Antibody Summary

Immunogen
GAGE1 (NP_001459.2, 1 a.a. - 139 a.a.) full-length human protein. MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
Specificity
GAGE1 - G antigen 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GAGE1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAGE1 Antibody

  • Antigen MZ2-F
  • Cancer/testis antigen 4.1
  • G antigen 1
  • GAGE-1
  • member 1
  • MGC33825
  • MZ2-F antigen

Background

This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-98298
Species: Hu
Applications: WB
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-45720
Species: Hu
Applications: WB, IHC, IF
NBP2-14921
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-10939
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00002543-B01P
Species: Hu
Applications: WB, IHC-P

Publications for GAGE1 Antibody (H00002543-B01P) (0)

There are no publications for GAGE1 Antibody (H00002543-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAGE1 Antibody (H00002543-B01P) (0)

There are no reviews for GAGE1 Antibody (H00002543-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAGE1 Antibody (H00002543-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAGE1 Products

Bioinformatics Tool for GAGE1 Antibody (H00002543-B01P)

Discover related pathways, diseases and genes to GAGE1 Antibody (H00002543-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAGE1 Antibody (H00002543-B01P)

Discover more about diseases related to GAGE1 Antibody (H00002543-B01P).
 

Pathways for GAGE1 Antibody (H00002543-B01P)

View related products by pathway.

PTMs for GAGE1 Antibody (H00002543-B01P)

Learn more about PTMs related to GAGE1 Antibody (H00002543-B01P).

Blogs on GAGE1

There are no specific blogs for GAGE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAGE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAGE1
Entrez
Uniprot