GADD45 alpha Recombinant Protein Antigen

Images

 
There are currently no images for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GADD45 alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GADD45 alpha.

Source: E. coli

Amino Acid Sequence: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GADD45A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55059.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GADD45 alpha Recombinant Protein Antigen

  • DDIT-1
  • DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha
  • DNA damage-inducible transcript 1 protein
  • DNA damage-inducible transcript-1
  • GADD45 alpha
  • GADD45a
  • GADD45DNA-damage-inducible transcript 1
  • growth arrest and DNA-damage-inducible 45 alpha
  • growth arrest and DNA-damage-inducible, alpha

Background

GADD45A is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP3-12326
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-68858
Species: Hu
Applications: IHC,  IHC-P
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-84385
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-55059PEP
Species: Hu
Applications: AC

Publications for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

There are no publications for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

There are no reviews for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GADD45 alpha Products

Research Areas for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP)

Find related products by research area.

Blogs on GADD45 alpha

There are no specific blogs for GADD45 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GADD45 alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GADD45A