G protein alpha-13 Antibody

Images

 
Western Blot: G protein alpha-13 Antibody [NBP2-87479] - Host: Rabbit. Target Name: GNA13. Sample Tissue: Human Thymus Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G protein alpha-13 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human G protein alpha-13. Peptide sequence: APMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GNA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G protein alpha-13 Antibody

  • G alpha-13
  • G13
  • G-protein subunit alpha-13
  • guanine nucleotide binding protein (G protein), alpha 13
  • guanine nucleotide-binding protein subunit alpha-13
  • MGC46138

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-84308
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-98350
Species: Rt
Applications: WB
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-14867
Species: Hu
Applications: WB

Publications for G protein alpha-13 Antibody (NBP2-87479) (0)

There are no publications for G protein alpha-13 Antibody (NBP2-87479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G protein alpha-13 Antibody (NBP2-87479) (0)

There are no reviews for G protein alpha-13 Antibody (NBP2-87479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G protein alpha-13 Antibody (NBP2-87479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional G protein alpha-13 Products

Bioinformatics Tool for G protein alpha-13 Antibody (NBP2-87479)

Discover related pathways, diseases and genes to G protein alpha-13 Antibody (NBP2-87479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G protein alpha-13 Antibody (NBP2-87479)

Discover more about diseases related to G protein alpha-13 Antibody (NBP2-87479).
 

Pathways for G protein alpha-13 Antibody (NBP2-87479)

View related products by pathway.

PTMs for G protein alpha-13 Antibody (NBP2-87479)

Learn more about PTMs related to G protein alpha-13 Antibody (NBP2-87479).
 

Research Areas for G protein alpha-13 Antibody (NBP2-87479)

Find related products by research area.

Blogs on G protein alpha-13

There are no specific blogs for G protein alpha-13, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G protein alpha-13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNA13