FXYD3 Recombinant Protein Antigen

Images

 
There are currently no images for FXYD3 Protein (NBP1-81256PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FXYD3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FXYD3.

Source: E. coli

Amino Acid Sequence: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FXYD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81256.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FXYD3 Recombinant Protein Antigen

  • Chloride conductance inducer protein Mat-8
  • FXYD domain containing ion transport regulator 3
  • FXYD domain-containing ion transport regulator 3
  • Mammary tumor 8 kDa protein
  • MAT8MAT-8
  • phospholemman-like protein
  • Phospholemman-like
  • PLMLMGC111076

Background

FXYD3, also known as FXYD domain-containing ion transport regulator 3, consists of 3 isoforms, a 87 amino acid isoform that is 9 kDa, a 113 amino acid isoform that is 12 kDa, and a 144 amino acid that is 15 kDa; is membrane located, functions as an inducer of a hyperpolarization-activated chloride current when expressed in Xenopus oocytes, and may be a modulator capable of activating endogenous oocyte channels. Current research is being performed on several diseases and disorders including adenocarcinoma, pancreatic, ductal adenocarcinoma, intrahepatic cholangiocarcinoma, colorectal cancer, cholangiocarcinoma prostate carcinoma, melanoma, pancreatic cancer, pancreatitis, prostate cancer, breast cancer, and prostatitis. The FXYD3 protein has also shown an interaction with SERBP1, FBXL12, NR4A1, MAPK6 and NUDT3, in the regulation of catalytic activity, ion transport, and chloride transport pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-47156
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP2-48725
Species: Hu
Applications: IHC,  IHC-P, WB
H00010926-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
H00000486-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, ELISA(Cap), S-ELISA, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-31944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-03498
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-81950
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-38904
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82486
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2957
Species: Hu
Applications: IHC, KO, WB
MAB6734
Species: Hu
Applications: IHC
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-00880
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for FXYD3 Protein (NBP1-81256PEP) (0)

There are no publications for FXYD3 Protein (NBP1-81256PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD3 Protein (NBP1-81256PEP) (0)

There are no reviews for FXYD3 Protein (NBP1-81256PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FXYD3 Protein (NBP1-81256PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FXYD3 Products

Blogs on FXYD3.

Myc-tag: The "Monkey Wrench" of Proteomic Tools
c-Myc is a well-characterized transcription factor encoded by the c-Myc gene on human chromosome 8q24. This cellular proto-oncogene, also known as p62, is commonly activated in a variety of tumor cells and plays a crucial role in cellular proliferatio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FXYD3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD3