FSCB Antibody - BSA Free

Western Blot: FSCB Antibody [NBP2-82845] - Host: Rabbit. Target Name: FSCB. Sample Tissue: Rat Lung lysates. Antibody Dilution: 1ug/ml

Product Discontinued

FSCB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FSCB Antibody - BSA Free (NBP2-82845) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of rat FSCB. Peptide sequence: RSQQTSCTGDWSLIYICPKEKVDKEQQTYFSELEIIIRSIPGSSMTKSKE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FSCB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FSCB Antibody - BSA Free

• C14orf155DKFZp686A1639
• chromosome 14 open reading frame 155
• DKFZp434F1017
• DKFZp686J0539
• fibrous sheath CABYR binding protein
• fibrous sheath CABYR-binding protein

Background

FSCB may be involved in the later stages of fibrous sheath biogenesis. Binds calcium

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FSCB