Recombinant Human FRG1 Protein

Images

 
SDS-Page: Recombinant Human FRG1 Protein [H00002483-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FRG1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 159-258 of Human FRG1

Source: Wheat Germ

Amino Acid Sequence: CNEAGDIEAKSKTAGEEEMIKIRSCAERETKKKDDIPEEDKGNVKQCEINYVKKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FRG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FRG1 Protein

  • facioscapulohumeral muscular dystrophy region gene-1
  • FSG1FRG1A
  • FSHD region gene 1 protein
  • FSHD region gene 1
  • protein FRG1

Background

This gene maps to a location 100 kb centromeric of the repeat units on chromosome 4q35 which are deleted in facioscapulohumeral muscular dystrophy (FSHD). It is evolutionarily conserved and has related sequences on multiple human chromosomes but DNA sequence analysis did not reveal any homology to known genes. In vivo studies demonstrate the encoded protein is localized to the nucleolus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49552
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56511
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82819
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8064
Species: Hu
Applications: WB, IHC, ICC
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002483-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for FRG1 Partial Recombinant Protein (H00002483-Q01) (0)

There are no publications for FRG1 Partial Recombinant Protein (H00002483-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRG1 Partial Recombinant Protein (H00002483-Q01) (0)

There are no reviews for FRG1 Partial Recombinant Protein (H00002483-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FRG1 Partial Recombinant Protein (H00002483-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FRG1 Partial Recombinant Protein (H00002483-Q01)

Discover related pathways, diseases and genes to FRG1 Partial Recombinant Protein (H00002483-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRG1 Partial Recombinant Protein (H00002483-Q01)

Discover more about diseases related to FRG1 Partial Recombinant Protein (H00002483-Q01).
 

Pathways for FRG1 Partial Recombinant Protein (H00002483-Q01)

View related products by pathway.

PTMs for FRG1 Partial Recombinant Protein (H00002483-Q01)

Learn more about PTMs related to FRG1 Partial Recombinant Protein (H00002483-Q01).

Blogs on FRG1

There are no specific blogs for FRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FRG1 Antibody (4A5)
H00002483-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FRG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FRG1